Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Leptin receptor gene-related protein (Leprot)

This Recombinant Mouse Leptin receptor gene-related protein (Leprot) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Leptin receptor gene-related protein, OB-R gene-related protein, OB-RGRP

UniProt

O89013

Expression Region

1-131

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGVKALVALSFSGAIGLTFLMLGCALEDYGVYWPLFVLIFYVISPIPYFIAKRVTYDSD ATSSACRELAYFFTTGIVVSAFGLPVVLARVDVIKWGACGLVLAGNAVIFLTIQGFFLVF GRGDDFSWEQW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C Reactive Protein (CRP) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4B4]
TA807727AM 100 µL

C Reactive Protein (CRP) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4B4]

Sign In for Pricing
View Details
6-NED, SE [6-NED NHS ester]
214-AAT 1 mg

6-NED, SE [6-NED NHS ester]

Sign In for Pricing
View Details
Cathepsin G (CTSG) (NM_001911) Human Recombinant Protein
TP761143 50 µg

Cathepsin G (CTSG) (NM_001911) Human Recombinant Protein

Sign In for Pricing
View Details
4-O-Alpha-D-Glucopyranosylmoranoline
TRC-G450000-1MG 1 mg

4-O-Alpha-D-Glucopyranosylmoranoline

Sign In for Pricing
View Details
VAV3 Human Gene Knockout Kit (CRISPR)
KN418352 1 Kit

VAV3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cyclin D1 (G1-Cyclin & Mantle Cell Lymphoma Marker) (CCND1/3548), CF647 conjugate, 0.1mg/mL
BNC473548-500 1x 500 µL

Cyclin D1 (G1-Cyclin & Mantle Cell Lymphoma Marker) (CCND1/3548), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details