Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Leptin receptor gene-related protein (Leprot)

This Recombinant Mouse Leptin receptor gene-related protein (Leprot) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Leptin receptor gene-related protein, OB-R gene-related protein, OB-RGRP

UniProt

O89013

Expression Region

1-131

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGVKALVALSFSGAIGLTFLMLGCALEDYGVYWPLFVLIFYVISPIPYFIAKRVTYDSD ATSSACRELAYFFTTGIVVSAFGLPVVLARVDVIKWGACGLVLAGNAVIFLTIQGFFLVF GRGDDFSWEQW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (rKRT16/1714), CF594 conjugate, 0.1mg/mL
BNC942149-100 1x 100 µL

Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (rKRT16/1714), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
γ Secretase Antibody Sampler Kit
HAK21087 1 Kit

γ Secretase Antibody Sampler Kit

Sign In for Pricing
View Details
OR10G8 Human Gene Knockout Kit (CRISPR)
KN418050 1 Kit

OR10G8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ALDH7A1 Recombinant Rabbit Monoclonal Antibody [JE63-38]
HA720086 100 µL

ALDH7A1 Recombinant Rabbit Monoclonal Antibody [JE63-38]

Sign In for Pricing
View Details
CD81 / TAPA-1 (C81/2885R), CF740 conjugate, 0.1mg/mL
BNC742885-500 1x 500 µL

CD81 / TAPA-1 (C81/2885R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GSTM1 (1-159) Rabbit Polyclonal Antibody
AP23586PU-N 50 µL

GSTM1 (1-159) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details