Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant UPF0719 inner membrane protein yjfL (yjfL)

This Recombinant UPF0719 inner membrane protein yjfL (yjfL) spans the amino acid sequence from region 1-132.

Product Specifications

Product Name Alternative

UPF0719 inner membrane protein yjfL

UniProt

P0AF81

Expression Region

1-132

Origin

Escherichia coli O157:H7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHILDSLLAFSAYFFIGVAMVIIFLFIYSKITPHNEWQLIKNNNTAASLAFSGTLLGYVI PLSSAAINAVSIPDYFAWGGIALVIQLLVFAGVRLYMPALSEKIINHNTAAGMFMGTAAL AGGIFNAACMTW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL
BNC680225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF740 conjugate, 0.1mg/mL
BNC740861-500 1x 500 µL

HSP27 (G3.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF555 conjugate, 0.1mg/mL
BNC551052-500 1x 500 µL

CD3e (B-B12), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1953), CF488A conjugate, 0.1mg/mL
BNC881953-100 1x 100 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1953), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IL3RA / CD123 (Acute Myeloid Leukemia Marker) (IL3RA/1531), CF594 conjugate, 0.1mg/mL
BNC941531-500 1x 500 µL

IL3RA / CD123 (Acute Myeloid Leukemia Marker) (IL3RA/1531), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), Biotin conjugate, 0.1mg/mL
BNCB0633-500 1x 500 µL

Von Willebrand Factor (3E2D10), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details