Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yjgA (yjgA)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yjgA (yjgA) spans the amino acid sequence from region 1-132.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yjgA

UniProt

O35027

Expression Region

1-132

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRNRWIYAVFTILIIGLGLGSRAFSSVLPDTLNTYLGDSLWAAMIFTGCGFLFRKLKTM ITGIISLSFCFVIEFSQLYHAEWIDQIRDTSLGGLVLGYGFLWSDIEAYTIGIAACAAIE LLVLGIKKRRCM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Isotype Control, Mouse IgG1 Kappa (IGG1/1331), RPE-AstralTM616 Conjugate, 0.1 mg/mL
BNC161331-1ML 1x 1 mL

Isotype Control, Mouse IgG1 Kappa (IGG1/1331), RPE-AstralTM616 Conjugate, 0.1 mg/mL

Sign In for Pricing
View Details
Azasetron-D3 Hydrochloride
TRC-A802802-1MG 1 mg

Azasetron-D3 Hydrochloride

Sign In for Pricing
View Details
CD2 (LFA2/600), CF640R conjugate, 0.1mg/mL
BNC400600-500 1x 500 µL

CD2 (LFA2/600), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tryptophan Hydroxylase (TPH1) (NM_004179) Human Recombinant Protein
TP321254 20 µg

Tryptophan Hydroxylase (TPH1) (NM_004179) Human Recombinant Protein

Sign In for Pricing
View Details
Cell Meter™ Live Cell Caspase 10 Binding Assay Kit *Green Fluorescence*
20119-AAT 25 Tests

Cell Meter™ Live Cell Caspase 10 Binding Assay Kit *Green Fluorescence*

Sign In for Pricing
View Details
GYPB (NM_002100) Human Over-expression Lysate
LC419536 20 µg

GYPB (NM_002100) Human Over-expression Lysate

Sign In for Pricing
View Details