Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yjgA (yjgA)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yjgA (yjgA) spans the amino acid sequence from region 1-132.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yjgA

UniProt

O35027

Expression Region

1-132

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRNRWIYAVFTILIIGLGLGSRAFSSVLPDTLNTYLGDSLWAAMIFTGCGFLFRKLKTM ITGIISLSFCFVIEFSQLYHAEWIDQIRDTSLGGLVLGYGFLWSDIEAYTIGIAACAAIE LLVLGIKKRRCM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human LAIR2/CD306 Protein
PKSH031382 100 µg

Recombinant Human LAIR2/CD306 Protein

Sign In for Pricing
View Details
MIR6803 Human qPCR Primer Pair (MI0022648)
HP301404 200 Reactions

MIR6803 Human qPCR Primer Pair (MI0022648)

Sign In for Pricing
View Details
Drebrin (DBN1) Mouse Monoclonal Antibody [Clone ID: OTI4B1]
CF812128 100 µg

Drebrin (DBN1) Mouse Monoclonal Antibody [Clone ID: OTI4B1]

Sign In for Pricing
View Details
PLEKHO2 Antibody
KC-28900-01 50 μL

PLEKHO2 Antibody

Sign In for Pricing
View Details
PLEKHO2 Antibody
KC-28900-02 100 µL

PLEKHO2 Antibody

Sign In for Pricing
View Details
PLEKHO2 Antibody
KC-28900-03 1 mL

PLEKHO2 Antibody

Sign In for Pricing
View Details