Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vesicle transport protein GOT1A (GOLT1A)

This Recombinant Human Vesicle transport protein GOT1A (GOLT1A) spans the amino acid sequence from region 1-132.

Product Specifications

Product Name Alternative

Vesicle transport protein GOT1A, Golgi transport 1 homolog A, hGOT1b

UniProt

Q6ZVE7

Expression Region

1-132

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISITEWQKIGVGITGFGIFFILFGTLLYFDSVLLAFGNLLFLTGLSLIIGLRKTFWFFF QRHKLKGTSFLLGGVVIVLLRWPLLGMFLETYGFFSLFKGFFPVAFGFLGNVCNIPFLGA LFRRLQGTSSMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL
BNC400031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL
BNC740270-500 1x 500 µL

Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MHC II (HLA-DQ) (SPV-L3), CF640R conjugate, 0.1mg/mL
BNC400200-500 1x 500 µL

MHC II (HLA-DQ) (SPV-L3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX2 (Transcription Factor) (SOX2/1791), CF405S conjugate, 0.1mg/mL
BNC041791-100 1x 100 µL

SOX2 (Transcription Factor) (SOX2/1791), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AMACR / p504S (Prostate Cancer Marker) (AMACR/1864), CF405S conjugate, 0.1mg/mL
BNC041864-100 1x 100 µL

AMACR / p504S (Prostate Cancer Marker) (AMACR/1864), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vitronectin Receptor / CD51 / CD61 (23C6), CF740 conjugate, 0.1mg/mL
BNC741471-500 1x 500 µL

Vitronectin Receptor / CD51 / CD61 (23C6), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details