Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anaerobic C4-dicarboxylate transporter DcuA (dcuA)

This Recombinant Anaerobic C4-dicarboxylate transporter DcuA (dcuA) spans the amino acid sequence from region 1-132.

Product Specifications

Product Name Alternative

Anaerobic C4-dicarboxylate transporter DcuA

UniProt

P40684

Expression Region

1-132

Origin

Serratia marcescens

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLAVELVIVLLAIFLGARLGGIGIGFAGGLGVLALALIGVKPGNIPFDVISIIMAVIAAI SAMQVAGGMDYLVQQTEKLLRKNPKHITILAPIVTYFLTIFAGTGNISLSALPVIAEVAK EQGIKPCRPLST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL
BNC740204-100 1x 100 µL

Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL
BNC040225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF568 conjugate, 0.1mg/mL
BNC680342-100 1x 100 µL

CD43 (84-3C1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL
BNC470253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF594 conjugate, 0.1mg/mL
BNC940449-100 1x 100 µL

CD104 (UM-A9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RB (B-Cell Marker) (PTPRC/1783R), CF594 conjugate, 0.1mg/mL
BNC941783-100 1x 100 µL

CD45RB (B-Cell Marker) (PTPRC/1783R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details