Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yvaD (yvaD)

This Recombinant Bacillus subtilis Uncharacterized protein yvaD (yvaD) spans the amino acid sequence from region 1-133.

Product Specifications

Product Name Alternative

Uncharacterized protein yvaD

UniProt

O32226

Expression Region

1-133

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRYMKLFFLVTDIGFILYWLSAGFSLIPESWAFKHHDHPFMIAWNWSFFPLDILISVTGL YSLYLQRVNRADWKLMALISLVLTCCSGLQALSFWTFSSDFDLVWWLFNGYLLIYPLFFI HLLLKEGRRTKQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS645442 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
PADI1 (NM_013358) Human Recombinant Protein
TP313501M 100 µg

PADI1 (NM_013358) Human Recombinant Protein

Sign In for Pricing
View Details
2,3,5-Trichloropyridin-4-amine
TRC-T899590-50MG 50 mg

2,3,5-Trichloropyridin-4-amine

Sign In for Pricing
View Details
MALT-1 (MT1/410), 1mg/mL
BNUM0410-50 1x 50 µL

MALT-1 (MT1/410), 1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS703269 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Recombinant ERAP1 Antibody
RC-4076-01 50 μL

Recombinant ERAP1 Antibody

Sign In for Pricing
View Details