Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 60 (Tmem60)

This Recombinant Mouse Transmembrane protein 60 (Tmem60) spans the amino acid sequence from region 1-133.

Product Specifications

Product Name Alternative

Transmembrane protein 60

UniProt

Q8K174

Expression Region

1-133

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRMSLAQRVLLTWLFTLLFLIMLVLKLDEKAPWNWFLIFIPVWIFDTILLVMLIVKMAGR CKSGFDPRHGSHNIKKKAWYLIAMLLKLAFCLALCAKLEQFTTMNLSYVFIPLWALLAGA LTELGYNVFFVRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TIGIT knockdown cell line
ABC-KD15429 1 Vial

Human TIGIT knockdown cell line

Sign In for Pricing
View Details
TFB2M (E5P6W) Rabbit Monoclonal Antibody
CST 50837S 100 µL

TFB2M (E5P6W) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Glypican 3 (GPC3) (NM_001164618) Human Over-expression Lysate
LC431487 20 µg

Glypican 3 (GPC3) (NM_001164618) Human Over-expression Lysate

Sign In for Pricing
View Details
4- (3-Chloro-5-trifluoromethyl-pyridine-2-carbonyl) -piperazine-1-carboxylic acid tert-butyl ester
PC109778 250 mg

4- (3-Chloro-5-trifluoromethyl-pyridine-2-carbonyl) -piperazine-1-carboxylic acid tert-butyl ester

Sign In for Pricing
View Details
Human Septin-7, SEPTIN7 ELISA KIT
E3429Hu-01 48 Well

Human Septin-7, SEPTIN7 ELISA KIT

Sign In for Pricing
View Details
Human Septin-7, SEPTIN7 ELISA KIT
E3429Hu-02 96 Well

Human Septin-7, SEPTIN7 ELISA KIT

Sign In for Pricing
View Details