Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 60 (Tmem60)

This Recombinant Mouse Transmembrane protein 60 (Tmem60) spans the amino acid sequence from region 1-133.

Product Specifications

Product Name Alternative

Transmembrane protein 60

UniProt

Q8K174

Expression Region

1-133

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRMSLAQRVLLTWLFTLLFLIMLVLKLDEKAPWNWFLIFIPVWIFDTILLVMLIVKMAGR CKSGFDPRHGSHNIKKKAWYLIAMLLKLAFCLALCAKLEQFTTMNLSYVFIPLWALLAGA LTELGYNVFFVRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine CAS1 domain containing protein 1 (CASD1) ELISA Kit
GTR10351461 96 Well

Porcine CAS1 domain containing protein 1 (CASD1) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Malondialdehyde Antibody (6H6) [DyLight 680]
NBP2-59366FR 100 µL

Mouse Monoclonal Malondialdehyde Antibody (6H6) [DyLight 680]

Sign In for Pricing
View Details
Celf2 (NM_001110230) Mouse Untagged Clone
MC217421 10 µg

Celf2 (NM_001110230) Mouse Untagged Clone

Sign In for Pricing
View Details
Relugolix Impurity 18
RM-R051218-01 10 mg

Relugolix Impurity 18

Sign In for Pricing
View Details
Relugolix Impurity 18
RM-R051218-02 25 mg

Relugolix Impurity 18

Sign In for Pricing
View Details
Relugolix Impurity 18
RM-R051218-03 50 mg

Relugolix Impurity 18

Sign In for Pricing
View Details