Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 60 (Tmem60)

This Recombinant Mouse Transmembrane protein 60 (Tmem60) spans the amino acid sequence from region 1-133.

Product Specifications

Product Name Alternative

Transmembrane protein 60

UniProt

Q8K174

Expression Region

1-133

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRMSLAQRVLLTWLFTLLFLIMLVLKLDEKAPWNWFLIFIPVWIFDTILLVMLIVKMAGR CKSGFDPRHGSHNIKKKAWYLIAMLLKLAFCLALCAKLEQFTTMNLSYVFIPLWALLAGA LTELGYNVFFVRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GMPPA Rabbit Polyclonal Antibody
orb627400-01 50 µg

GMPPA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GMPPA Rabbit Polyclonal Antibody
orb627400-02 100 µg

GMPPA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mcm8-set siRNA/shRNA/RNAi Lentivector (Mouse)
28234094 4x 500 ng

Mcm8-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Recombinant Shigella Sonnei ihfA Protein (aa 1-99)
VAng-Lsx09777-500gEcoli 500 µg (E. coli)

Recombinant Shigella Sonnei ihfA Protein (aa 1-99)

Sign In for Pricing
View Details
MLKL polyclonal antibody
orb1495819-01 50 μL

MLKL polyclonal antibody

Sign In for Pricing
View Details
MLKL polyclonal antibody
orb1495819-02 100 µL

MLKL polyclonal antibody

Sign In for Pricing
View Details