Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Protein msa (msa)

This Recombinant Staphylococcus aureus Protein msa (msa) spans the amino acid sequence from region 1-133.

Product Specifications

Product Name Alternative

Protein msa, Modulator of sarA

UniProt

Q2FYN3

Expression Region

1-133

Origin

Staphylococcus aureus (strain NCTC 8325)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKYLILSLVANLLVFGVLSAIGLNINILAAMMIVLVIPIMISGILFFKTNIDKTYIFFNI IFIDFYYYIYNVHLMTLPKFNNYIKAEMMELEDIDVLITSKDFGFDEILFYTLYLLLILI VLYYLKKQVKHKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LentimiRa-Off-mmu-miR-106a-5p Vector
mm30031 500 ng

LentimiRa-Off-mmu-miR-106a-5p Vector

Sign In for Pricing
View Details
CCDC52 Rabbit Polyclonal Antibody
orb2350-01 50 μL

CCDC52 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CCDC52 Rabbit Polyclonal Antibody
orb2350-02 100 µL

CCDC52 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CCDC52 Rabbit Polyclonal Antibody
orb2350-03 200 µL

CCDC52 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-CYB5B Antibody Picoband®, FITC Conjugate
A09841-1-FITC 100 µg/Vial

Anti-CYB5B Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
MFAP2 Rabbit Polyclonal Antibody (HRP)
orb2102429 100 µL

MFAP2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details