Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Protein msa (msa)

This Recombinant Staphylococcus aureus Protein msa (msa) spans the amino acid sequence from region 1-133.

Product Specifications

Product Name Alternative

Protein msa, Modulator of sarA

UniProt

Q2YY17

Expression Region

1-133

Origin

Staphylococcus aureus (strain bovine RF122 / ET3-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKYLILSLVANLLVFGVLSAIGLNINILAAMMMILVIPITISGILFFKTNLDKTYIFFNI LFIDFYYYIYNVHLMALPRFNSYIKAEMMELEDIDVLITSKDFGFDEILFFTLYLLLILI ILYYLKKQVKTKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Integrin beta 6 Antibody
NBP2-14136-25ul 25 µL

Rabbit Polyclonal Integrin beta 6 Antibody

Sign In for Pricing
View Details
NAMPT Antibody
OACD00234-1ML 1 mL

NAMPT Antibody

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Uncharacterized acyltransferase YDR018C (YDR018C)
orb2914540-01 20 µg

Recombinant Saccharomyces cerevisiae Uncharacterized acyltransferase YDR018C (YDR018C)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Uncharacterized acyltransferase YDR018C (YDR018C)
orb2914540-02 100 µg

Recombinant Saccharomyces cerevisiae Uncharacterized acyltransferase YDR018C (YDR018C)

Sign In for Pricing
View Details
VEZF1 Rabbit Polyclonal Antibody
orb324621 100 µL

VEZF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
INPPL1 polyclonal antibody
orb1722491-01 50 µL

INPPL1 polyclonal antibody

Sign In for Pricing
View Details