Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Protein msa (msa)

This Recombinant Staphylococcus aureus Protein msa (msa) spans the amino acid sequence from region 1-133.

Product Specifications

Product Name Alternative

Protein msa, Modulator of sarA

UniProt

Q2YY17

Expression Region

1-133

Origin

Staphylococcus aureus (strain bovine RF122 / ET3-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKYLILSLVANLLVFGVLSAIGLNINILAAMMMILVIPITISGILFFKTNLDKTYIFFNI LFIDFYYYIYNVHLMALPRFNSYIKAEMMELEDIDVLITSKDFGFDEILFFTLYLLLILI ILYYLKKQVKTKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF alpha Rabbit Polyclonal Antibody (Cy5)
orb966343 100 µL

TNF alpha Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Hoxb1 ORF Vector (Mouse) (pORF)
ORF047395 1.0 µg DNA

Hoxb1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Farnesoid X Receptor (FXR)
MBS2062435-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Farnesoid X Receptor (FXR)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Farnesoid X Receptor (FXR)
MBS2062435-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Farnesoid X Receptor (FXR)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Farnesoid X Receptor (FXR)
MBS2062435-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Farnesoid X Receptor (FXR)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Farnesoid X Receptor (FXR)
MBS2062435-04 1 mL

Cy3-Linked Polyclonal Antibody to Farnesoid X Receptor (FXR)

Sign In for Pricing
View Details