Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis UPF0344 protein SERP0557 (SERP0557)

This Recombinant Staphylococcus epidermidis UPF0344 protein SERP0557 (SERP0557) spans the amino acid sequence from region 1-133.

Product Specifications

Product Name Alternative

UPF0344 protein SERP0557

UniProt

Q5HQJ2

Expression Region

1-133

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLHVHILSWVLAIILFIATYLNYSKTQGASPYYKPLHMALRLFMLLTLISGFWELIEEFM AASNGEGGNHMLLTLKMLCGLAVIAFMEISIAKRKKQQTSHKFFWITIILIIITMAIGVI LPWGPISKIFGIS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MARCH11 Polyclonal Antibody, PE Conjugated
bs-9345R-PE 100 µL

MARCH11 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Recombinant Human TNNI3K Protein - (Dry Ice)
H00051086-P01-25ug 25 µg

Recombinant Human TNNI3K Protein - (Dry Ice)

Sign In for Pricing
View Details
SLC41A3 Protein Vector (Rat) (pPB-C-His)
PV306146 500 ng

SLC41A3 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Sheep Very Low Density Lipoproteins ELISA Kit
MBS037381-01 48 Well

Sheep Very Low Density Lipoproteins ELISA Kit

Sign In for Pricing
View Details
Sheep Very Low Density Lipoproteins ELISA Kit
MBS037381-02 96 Well

Sheep Very Low Density Lipoproteins ELISA Kit

Sign In for Pricing
View Details
Sheep Very Low Density Lipoproteins ELISA Kit
MBS037381-03 5x 96 Well

Sheep Very Low Density Lipoproteins ELISA Kit

Sign In for Pricing
View Details