Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Protein msa (msa)

This Recombinant Staphylococcus aureus Protein msa (msa) spans the amino acid sequence from region 1-133.

Product Specifications

Product Name Alternative

Protein msa, Modulator of sarA

UniProt

Q7A5P4

Expression Region

1-133

Origin

Staphylococcus aureus (strain N315)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKYLILSLVANLLVFGVLSAIGLNINILAAMMIVLVIPIMISGILFFKTNIDKTYIFFNI IFIDFYYYIYNVHLMTLPKFNNYIKAEMMELEDIDVLITSKDFGFDEILFYTLYLLLILI VLYYLKKQVKHKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hexahydro-6-methyl-1H-1,4-Diazepine-1-carboxylic Acid 1,1-Dimethylethyl Ester
164404 1 g

Hexahydro-6-methyl-1H-1,4-Diazepine-1-carboxylic Acid 1,1-Dimethylethyl Ester

Sign In for Pricing
View Details
DONSON Blocking Peptide
33R-2048 0.1 mg

DONSON Blocking Peptide

Sign In for Pricing
View Details
RBP4 Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-61564R-BF594-TR 20 µL

RBP4 Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Vitronectin Receptor / CD51 / CD61 (23C6), CF594 conjugate, 0.1mg/mL
BNC941471-500 1x 500 µL

Vitronectin Receptor / CD51 / CD61 (23C6), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SFTPA2 siRNA Oligos set (Human)
43608171 3x 5 nmol

SFTPA2 siRNA Oligos set (Human)

Sign In for Pricing
View Details
ASB6 Antibody
A67812-100UG 100 µg

ASB6 Antibody

Sign In for Pricing
View Details