Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Protein msa (msa)

This Recombinant Staphylococcus aureus Protein msa (msa) spans the amino acid sequence from region 1-133.

Product Specifications

Product Name Alternative

Protein msa, Modulator of sarA

UniProt

Q6GH07

Expression Region

1-133

Origin

Staphylococcus aureus (strain MRSA252)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKYLILSLVANLLVFGVLSAIGLNINILAAMMIVLVIPIMISGIVFFKTNIDKTYIFFNI IFIDFYYYIYNVHLMTLPKFNNYIKTEMMELEHIDVLITSKDFGFDEILFFTLYLLLILI VLYYLKKQLKNKT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF4EP2 sgRNA CRISPR Lentivector (Human) (Target 2)
K0670803 1.0 µg DNA

EIF4EP2 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Mouse glomerular basement membrane antibogy (GBM-Ab) ELISA Kit
YP-W24008-01 48 Tests

Mouse glomerular basement membrane antibogy (GBM-Ab) ELISA Kit

Sign In for Pricing
View Details
Mouse glomerular basement membrane antibogy (GBM-Ab) ELISA Kit
YP-W24008-02 96 Tests

Mouse glomerular basement membrane antibogy (GBM-Ab) ELISA Kit

Sign In for Pricing
View Details
Il33 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4380407 1.0 µg DNA

Il33 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Guinea Pig CKLF like MARVEL transmembrane domain containing protein 5 (CMTM5) ELISA kit
GTR10385043 96 Well

Guinea Pig CKLF like MARVEL transmembrane domain containing protein 5 (CMTM5) ELISA kit

Sign In for Pricing
View Details
Human CCL3 knockdown cell line
ABC-KD2613 1 Vial

Human CCL3 knockdown cell line

Sign In for Pricing
View Details