Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Protein msa (msa)

This Recombinant Staphylococcus aureus Protein msa (msa) spans the amino acid sequence from region 1-133.

Product Specifications

Product Name Alternative

Protein msa, Modulator of sarA

UniProt

Q6GH07

Expression Region

1-133

Origin

Staphylococcus aureus (strain MRSA252)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKYLILSLVANLLVFGVLSAIGLNINILAAMMIVLVIPIMISGIVFFKTNIDKTYIFFNI IFIDFYYYIYNVHLMTLPKFNNYIKTEMMELEHIDVLITSKDFGFDEILFFTLYLLLILI VLYYLKKQLKNKT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glecaprevir 100mg
A16948-100 100 mg

Glecaprevir 100mg

Sign In for Pricing
View Details
MAP Kinase Kinase 5 (Ser149) (Dual Specificity Mitogen-activated Protein Kinase Kinase 5, MAP2K5, MAPKK 5, MAPKK5, MKK5, PRKMK5, HsT17454, MAPK/ERK Kinase 5, MEK 5, MEK5) (MaxLight 550) discontinued
M2363-19M-ML550 100 µL

MAP Kinase Kinase 5 (Ser149) (Dual Specificity Mitogen-activated Protein Kinase Kinase 5, MAP2K5, MAPKK 5, MAPKK5, MKK5, PRKMK5, HsT17454, MAPK/ERK Kinase 5, MEK 5, MEK5) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Anti-SMAD1/SMAD5 Antibody Picoband® (APC Conjugate)
A00728-1-APC 100 µg/Vial

Anti-SMAD1/SMAD5 Antibody Picoband® (APC Conjugate)

Sign In for Pricing
View Details
Lentiviral mouse F8 shRNA (UAS) - Lentiviral mouseF8 shRNA (UAS, GFP) (25)
GTR15294059 1 Vial

Lentiviral mouse F8 shRNA (UAS) - Lentiviral mouseF8 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
FGD2 shRNA (h) Lentiviral Particles
sc-41713-V 200 µL

FGD2 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
DS86760016
BA1518-1 1 mg

DS86760016

Sign In for Pricing
View Details