Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Protein msa (msa)

This Recombinant Staphylococcus aureus Protein msa (msa) spans the amino acid sequence from region 1-133.

Product Specifications

Product Name Alternative

Protein msa, Modulator of sarA

UniProt

Q6GH07

Expression Region

1-133

Origin

Staphylococcus aureus (strain MRSA252)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKYLILSLVANLLVFGVLSAIGLNINILAAMMIVLVIPIMISGIVFFKTNIDKTYIFFNI IFIDFYYYIYNVHLMTLPKFNNYIKTEMMELEHIDVLITSKDFGFDEILFFTLYLLLILI VLYYLKKQLKNKT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZCCHC7 Lentiviral Activation Particles (h)
sc-413572-LAC 200 µL

ZCCHC7 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Akap17a Rat shRNA Plasmid (Locus ID 288526)
TL708356 1 Kit

Akap17a Rat shRNA Plasmid (Locus ID 288526)

Sign In for Pricing
View Details
CCND3, Phosphorylated (S264) (CCND3, G1/S-specific cyclin-D3) (MaxLight 490)
MBS6282361-01 0.1 mL

CCND3, Phosphorylated (S264) (CCND3, G1/S-specific cyclin-D3) (MaxLight 490)

Sign In for Pricing
View Details
CCND3, Phosphorylated (S264) (CCND3, G1/S-specific cyclin-D3) (MaxLight 490)
MBS6282361-02 5x 0.1 mL

CCND3, Phosphorylated (S264) (CCND3, G1/S-specific cyclin-D3) (MaxLight 490)

Sign In for Pricing
View Details
CHD7 Human shRNA Plasmid Kit (Locus ID 55636)
TL305413 1 Kit

CHD7 Human shRNA Plasmid Kit (Locus ID 55636)

Sign In for Pricing
View Details
Lentiviral human MAP2 shRNA (UAS) - Lentiviral human MAP2 shRNA (UAS, GFP) (100)
GTR15309156 1 Vial

Lentiviral human MAP2 shRNA (UAS) - Lentiviral human MAP2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details