Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Vesicle transport protein GOT1A (Golt1a)

This Recombinant Mouse Vesicle transport protein GOT1A (Golt1a) spans the amino acid sequence from region 1-133.

Product Specifications

Product Name Alternative

Vesicle transport protein GOT1A, Golgi transport 1 homolog A

UniProt

Q9DCQ3

Expression Region

1-133

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISITEWQKIGVGITGFGVFFILFGILLYFDSVLLAFGNLLFLTGLSLIIGLRRTFAFFF QRHKLKGTSFFLGGVAIVLLRWPLLGMLLEAYGFISLFKGFFPVVFGFLGSAFNIPFLST LFQKLQGSSSSMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Cysteinyl-L-cysteinyl-L-Alpha-glutamyl-L-tyrosyl-L-cysteinyl-L-cysteinyl-L-asparaginyl-L-prolyl-L-alanyl-L-cysteinyl-L-threonylglycyl-L-cysteinyl-L-Tyrosine Trifluoroacetate
TRC-C994760-5MG 5 mg

L-Cysteinyl-L-cysteinyl-L-Alpha-glutamyl-L-tyrosyl-L-cysteinyl-L-cysteinyl-L-asparaginyl-L-prolyl-L-alanyl-L-cysteinyl-L-threonylglycyl-L-cysteinyl-L-Tyrosine Trifluoroacetate

Sign In for Pricing
View Details
Ethyl 6-(4-Chlorophenoxy)hexanoate
TRC-B126018-500MG 500 mg

Ethyl 6-(4-Chlorophenoxy)hexanoate

Sign In for Pricing
View Details
Human IFIT2 activation kit by CRISPRa
GA102323 1 Kit

Human IFIT2 activation kit by CRISPRa

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (rEGP40/1372), CF740 conjugate, 0.1mg/mL
BNC742172-500 1x 500 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (rEGP40/1372), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18/836), 0.2mg/mL
BNUB0836-500 1x 500 µL

Cytokeratin 18 (KRT18/836), 0.2mg/mL

Sign In for Pricing
View Details
(R)-Apremilast
TRC-A729705-25MG 25 mg

(R)-Apremilast

Sign In for Pricing
View Details