Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus pseudofirmus ATP synthase protein I (atpI)

This Recombinant Bacillus pseudofirmus ATP synthase protein I (atpI) spans the amino acid sequence from region 1-133.

Product Specifications

Product Name Alternative

ATP synthase protein I

UniProt

P22475

Expression Region

1-133

Origin

Bacillus pseudofirmus (strain OF4)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKMSSLQGKMRQHTIIVMTLLFLFITGYLLTQLKVQFLSFFAGLSVSFLNLWTTYYLAK VVGKVADQKRKHSVLPFILAGFGYLIRIVLALSVVYWALINPDTLNVLLVIAGISLIYAI IMLDMLFQFMRKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OAS3 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-7344R-PerCP-Cy5.5 100 µL

OAS3 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
EGFR/ERBB1/HER1 Human Monoclonal Antibody
orb2977257-01 100 µg

EGFR/ERBB1/HER1 Human Monoclonal Antibody

Sign In for Pricing
View Details
EGFR/ERBB1/HER1 Human Monoclonal Antibody
orb2977257-02 1 mg

EGFR/ERBB1/HER1 Human Monoclonal Antibody

Sign In for Pricing
View Details
Calcium-dependent phospholipase A2 (FITC)
308794-01 50 µg

Calcium-dependent phospholipase A2 (FITC)

Sign In for Pricing
View Details
Calcium-dependent phospholipase A2 (FITC)
308794-02 100 µg

Calcium-dependent phospholipase A2 (FITC)

Sign In for Pricing
View Details
ZFAND2A, ID (ZFAND2A, AN1-type zinc finger protein 2A) (MaxLight 550)
MBS6365113-01 0.1 mL

ZFAND2A, ID (ZFAND2A, AN1-type zinc finger protein 2A) (MaxLight 550)

Sign In for Pricing
View Details