Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus pseudofirmus ATP synthase protein I (atpI)

This Recombinant Bacillus pseudofirmus ATP synthase protein I (atpI) spans the amino acid sequence from region 1-133.

Product Specifications

Product Name Alternative

ATP synthase protein I

UniProt

P22475

Expression Region

1-133

Origin

Bacillus pseudofirmus (strain OF4)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKMSSLQGKMRQHTIIVMTLLFLFITGYLLTQLKVQFLSFFAGLSVSFLNLWTTYYLAK VVGKVADQKRKHSVLPFILAGFGYLIRIVLALSVVYWALINPDTLNVLLVIAGISLIYAI IMLDMLFQFMRKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITPKA Rabbit Polyclonal Antibody (FITC)
orb188707 100 µL

ITPKA Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
CD33 CytoSection
TS407023P5 25 Slides

CD33 CytoSection

Sign In for Pricing
View Details
Phospho-AKT1 (Tyr474) Polyclonal Antibody, RBITC Conjugated
bs-10133R-RBITC 100 µL

Phospho-AKT1 (Tyr474) Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
RIMKLA CRISPRa sgRNA lentivector (set of three targets)(Mouse)
39591124 3x 1.0µg DNA

RIMKLA CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
TMPRSS4 (NM_183247) Human Tagged ORF Clone
RC202384 10 µg

TMPRSS4 (NM_183247) Human Tagged ORF Clone

Sign In for Pricing
View Details
anti-GIMAP4
YF-PA26325 50 ul

anti-GIMAP4

Sign In for Pricing
View Details