Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus pseudofirmus ATP synthase protein I (atpI)

This Recombinant Bacillus pseudofirmus ATP synthase protein I (atpI) spans the amino acid sequence from region 1-133.

Product Specifications

Product Name Alternative

ATP synthase protein I

UniProt

P22475

Expression Region

1-133

Origin

Bacillus pseudofirmus (strain OF4)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKMSSLQGKMRQHTIIVMTLLFLFITGYLLTQLKVQFLSFFAGLSVSFLNLWTTYYLAK VVGKVADQKRKHSVLPFILAGFGYLIRIVLALSVVYWALINPDTLNVLLVIAGISLIYAI IMLDMLFQFMRKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bacillus anthracis Spore Antigen (Anthrax) discontinued
B0003-05G8 100 µg

Bacillus anthracis Spore Antigen (Anthrax) discontinued

Sign In for Pricing
View Details
Mouse 14-3-3 Protein epsilon (YWHAE) ELISA Kit
MBS7256473-01 48 Well

Mouse 14-3-3 Protein epsilon (YWHAE) ELISA Kit

Sign In for Pricing
View Details
Mouse 14-3-3 Protein epsilon (YWHAE) ELISA Kit
MBS7256473-02 96 Well

Mouse 14-3-3 Protein epsilon (YWHAE) ELISA Kit

Sign In for Pricing
View Details
Mouse 14-3-3 Protein epsilon (YWHAE) ELISA Kit
MBS7256473-03 5x 96 Well

Mouse 14-3-3 Protein epsilon (YWHAE) ELISA Kit

Sign In for Pricing
View Details
Mouse 14-3-3 Protein epsilon (YWHAE) ELISA Kit
MBS7256473-04 10x 96 Well

Mouse 14-3-3 Protein epsilon (YWHAE) ELISA Kit

Sign In for Pricing
View Details
Recombinant BH3 Interacting Domain Death Agonist (Bid)
TRV-0000792-01 10 µg

Recombinant BH3 Interacting Domain Death Agonist (Bid)

Sign In for Pricing
View Details