Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Putative oxidoreductase CatD (catD)

This Recombinant Bacillus subtilis Putative oxidoreductase CatD (catD) spans the amino acid sequence from region 1-134.

Product Specifications

Product Name Alternative

Putative oxidoreductase CatD, EC= 1.-.-.-

UniProt

P54720

Expression Region

1-134

Origin

Bacillus subtilis (strain 168)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKSFEIGTLLLRVITGIIFFVHGLSKFQGMEGTIQFFGSIGLPSFMAYVIAAIELIGGV LVFFGLATRIVGVLFALTLIGAIITVKLKAPFMGNAEFDYLLLLTSIHLALTGSRFLALD PFVFKGKKNGNVSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fn3k (BC054374) Mouse Tagged ORF Clone
MG202213 10 µg

Fn3k (BC054374) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Caspase-3 Antibody
F48960-0.4ML 0.4 mL

Caspase-3 Antibody

Sign In for Pricing
View Details
Human C20orf20 (MRGBP) activation kit by CRISPRa
GA110650 1 Kit

Human C20orf20 (MRGBP) activation kit by CRISPRa

Sign In for Pricing
View Details
Histone H2B Mouse Monoclonal Antibody [Clone ID: C14264]
AM26683AF-N 100 µg

Histone H2B Mouse Monoclonal Antibody [Clone ID: C14264]

Sign In for Pricing
View Details
Recombinant Human GLT25D2 Protein (His Tag)
PKSH030820 100 µg

Recombinant Human GLT25D2 Protein (His Tag)

Sign In for Pricing
View Details
1700066B19Rik Mouse Gene Knockout Kit (CRISPR)
KN500155 1 Kit

1700066B19Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details