Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Putative oxidoreductase CatD (catD)

This Recombinant Bacillus subtilis Putative oxidoreductase CatD (catD) spans the amino acid sequence from region 1-134.

Product Specifications

Product Name Alternative

Putative oxidoreductase CatD, EC= 1.-.-.-

UniProt

P54720

Expression Region

1-134

Origin

Bacillus subtilis (strain 168)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKSFEIGTLLLRVITGIIFFVHGLSKFQGMEGTIQFFGSIGLPSFMAYVIAAIELIGGV LVFFGLATRIVGVLFALTLIGAIITVKLKAPFMGNAEFDYLLLLTSIHLALTGSRFLALD PFVFKGKKNGNVSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trans-Nerolidol (>90%)
TRC-N385810-1G 1 g

Trans-Nerolidol (>90%)

Sign In for Pricing
View Details
Mouse IL-1RA Recombinant Rabbit monoclonal Antibody
HA723697 100 µL

Mouse IL-1RA Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human DNAJC12 activation kit by CRISPRa
GA111193 1 Kit

Human DNAJC12 activation kit by CRISPRa

Sign In for Pricing
View Details
Rat SELL Antibody Pair Set
E-KAB-0361 50 µL & 100 µg

Rat SELL Antibody Pair Set

Sign In for Pricing
View Details
GATA-3 (Breast and Urothelial Marker) (GATA3/2444), CF740 conjugate, 0.1mg/mL
BNC742444-500 1x 500 µL

GATA-3 (Breast and Urothelial Marker) (GATA3/2444), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Zn-Nicotianamine
TRC-Z439750-25MG 25 mg

Zn-Nicotianamine

Sign In for Pricing
View Details