Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein CrcB homolog 3 (crcB3)

This Recombinant Protein CrcB homolog 3 (crcB3) spans the amino acid sequence from region 1-134.

Product Specifications

Product Name Alternative

Protein CrcB homolog 3

UniProt

Q667Q9

Expression Region

1-134

Origin

Yersinia pseudotuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPNLIILVFVGGAFGAMCREFIMLSVPRLADGFPMDIFVANIIAAFLLGLTTSFFKKDKI NQYVHLMVGTGIMGGLSTFSSFVFGAVEMMKNPTEVLVSICYLVASLIVGFIAVELGLMI GPKEKPKDPQVASE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL
BNC740146-100 1x 100 µL

CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF740 conjugate, 0.1mg/mL
BNC742853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF514 conjugate, 0.1mg/mL
BNC140146-100 1x 100 µL

CD10 (CB-CALLA), CF514 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
WIPI2 (2A2), CF640R conjugate, 0.1mg/mL
BNC402904-500 1x 500 µL

WIPI2 (2A2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1409R), CF740 conjugate, 0.1mg/mL
BNC741409-100 1x 100 µL

MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1409R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8A (Cytotoxic-&Suppressor T-Cell Marker) (rC8/468), CF405S conjugate, 0.1mg/mL
BNC041867-100 1x 100 µL

CD8A (Cytotoxic-&Suppressor T-Cell Marker) (rC8/468), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details