Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein psiE homolog (psiE)

This Recombinant Protein psiE homolog (psiE) spans the amino acid sequence from region 1-134.

Product Specifications

Product Name Alternative

Protein psiE homolog

UniProt

Q81XB6

Expression Region

1-134

Origin

Bacillus anthracis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSFNIDHFIASVLQWILNIALIILSIVLSIFLINETITFIQYIFSAKKYTSYKLVESII VYFLYFEFIALIIKYFKSNYHFPLRYFIYIGITALIRLIIVSHEEPMETLLYAGAILVLV IALYISNMRDLRKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (84-3C1), CF405S conjugate, 0.1mg/mL
BNC040342-500 1x 500 µL

CD43 (84-3C1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF405S conjugate, 0.1mg/mL
BNC040149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL
BNC040009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL
BNC881037-100 1x 100 µL

CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P40 (Rabbit PAb), CF740 conjugate, 0.1mg/mL
BNC740375-500 1x 500 µL

P40 (Rabbit PAb), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PCNA (PCNA/694), CF405S conjugate, 0.1mg/mL
BNC040694-100 1x 100 µL

PCNA (PCNA/694), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details