Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein CrcB homolog 2 (crcB2)

This Recombinant Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-134.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q8ZDB2

Expression Region

1-134

Origin

Yersinia pestis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPNLIILVFVGGAFGAMCREFIMLSVPRLADGFPMDIFVANIIAAFLLGLTTSFFKKDKI NQYVHLMVGTGIMGGLSTFSSFVFGAVEMMKNPTEVLVSICYLVASLIVGFIAVELGLMI GPKEKPKDPQVASE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF640R conjugate, 0.1mg/mL
BNC400151-100 1x 100 µL

CD11a (Cris-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF488A conjugate, 0.1mg/mL
BNC880253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL
BNC880008-100 1x 100 µL

MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL
BNC040253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL
BNC400257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD147 (8D6), CF647 conjugate, 0.1mg/mL
BNC470424-500 1x 500 µL

CD147 (8D6), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details