Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis UPF0719 transmembrane protein yshE (yshE)

This Recombinant Bacillus subtilis UPF0719 transmembrane protein yshE (yshE) spans the amino acid sequence from region 1-134.

Product Specifications

Product Name Alternative

UPF0719 transmembrane protein yshE

UniProt

P94546

Expression Region

1-134

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDFWENELVEIAAYYSVAVLCLVLFLTVFELVTAYKNWEEIQKGNLAVAMATGGKILGI ANVFQHSISQHNSLLQMIGWGVYGFVMLLISYFIFEFLTPRFKIDQEIENDNRAVGFISF VISVGLSFVVAAGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FGF-b ELISA Kit (48-well)
EA100085 48 Well

Human FGF-b ELISA Kit (48-well)

Sign In for Pricing
View Details
(+)-Muscarine-d9 Iodide
TRC-M814002-25MG 25 mg

(+)-Muscarine-d9 Iodide

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/760 + KRT7/903), CF740 conjugate, 0.1mg/mL
BNC740906-100 1x 100 µL

Cytokeratin 7 (KRT7/760 + KRT7/903), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IP3 receptor (ITPR1) Rabbit Monoclonal Antibody [Clone ID: R08-3P-1]
TA421945 100 µL

IP3 receptor (ITPR1) Rabbit Monoclonal Antibody [Clone ID: R08-3P-1]

Sign In for Pricing
View Details
ALK (NM_004304) Human Recombinant Protein
TP700155 20 µg

ALK (NM_004304) Human Recombinant Protein

Sign In for Pricing
View Details
PSPC1 (NM_001042414) Human Recombinant Protein
TP323202 20 µg

PSPC1 (NM_001042414) Human Recombinant Protein

Sign In for Pricing
View Details