Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida ATP synthase protein I (atpI)

This Recombinant Pseudomonas putida ATP synthase protein I (atpI) spans the amino acid sequence from region 1-135.

Product Specifications

Product Name Alternative

ATP synthase protein I

UniProt

P0A103

Expression Region

1-135

Origin

Pseudomonas putida (strain KT2440)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIRTPNRLPFHRWAVFPVLLAQFVVLLLATLVLWQWKGSVSGYSGLCGGLIAWLPNVYF AWKAFRFSGARAAQAIVKSFYAGEAGKMILTAVLFALTFAGVKPLAPLAVFGVFVLTLLV SWFAPLLMNKRLSRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Aminoethanol Hydrochloride
TRC-A576798-500MG 500 mg

2-Aminoethanol Hydrochloride

Sign In for Pricing
View Details
Ethion
TRC-E678305-1G 1 g

Ethion

Sign In for Pricing
View Details
PEDF (SERPINF1) (NM_002615) Human Over-expression Lysate
LC400927 20 µg

PEDF (SERPINF1) (NM_002615) Human Over-expression Lysate

Sign In for Pricing
View Details
CTLA4 Antibody
KC-293-01 50 μL

CTLA4 Antibody

Sign In for Pricing
View Details
CTLA4 Antibody
KC-293-02 100 µL

CTLA4 Antibody

Sign In for Pricing
View Details
CTLA4 Antibody
KC-293-03 1 mL

CTLA4 Antibody

Sign In for Pricing
View Details