Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida ATP synthase protein I (atpI)

This Recombinant Pseudomonas putida ATP synthase protein I (atpI) spans the amino acid sequence from region 1-135.

Product Specifications

Product Name Alternative

ATP synthase protein I

UniProt

P0A103

Expression Region

1-135

Origin

Pseudomonas putida (strain KT2440)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIRTPNRLPFHRWAVFPVLLAQFVVLLLATLVLWQWKGSVSGYSGLCGGLIAWLPNVYF AWKAFRFSGARAAQAIVKSFYAGEAGKMILTAVLFALTFAGVKPLAPLAVFGVFVLTLLV SWFAPLLMNKRLSRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polr2k (BC028543) Mouse Tagged ORF Clone
MG200028 10 µg

Polr2k (BC028543) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Senataxin (SETX) Human Gene Knockout Kit (CRISPR)
KN422616 1 Kit

Senataxin (SETX) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DMC1 (2H12/4), CF647 conjugate, 0.1mg/mL
BNC472178-500 1x 500 µL

DMC1 (2H12/4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PPIG Rabbit Polyclonal Antibody
TA380213 100 µL

PPIG Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZNF346 Rabbit Polyclonal Antibody
TA365395 100 µL

ZNF346 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AAL-993
SIH-424-25MG 25 mg

AAL-993

Sign In for Pricing
View Details