Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida ATP synthase protein I (atpI)

This Recombinant Pseudomonas putida ATP synthase protein I (atpI) spans the amino acid sequence from region 1-135.

Product Specifications

Product Name Alternative

ATP synthase protein I

UniProt

P0A104

Expression Region

1-135

Origin

Pseudomonas putida (Arthrobacter siderocapsulatus)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIRTPNRLPFHRWAVFPVLLAQFVVLLLATLVLWQWKGSVSGYSGLCGGLIAWLPNVYF AWKAFRFSGARAAQAIVKSFYAGEAGKMILTAVLFALTFAGVKPLAPLAVFGVFVLTLLV SWFAPLLMNKRLSRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nrip2 (BC094230) Mouse Tagged ORF Clone
MG200595 10 µg

Nrip2 (BC094230) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
rac Deprenyl-d8
TRC-D288642-25MG 25 mg

rac Deprenyl-d8

Sign In for Pricing
View Details
Recombinant PROX1 Antibody
RC-15579-01 50 μL

Recombinant PROX1 Antibody

Sign In for Pricing
View Details
Recombinant PROX1 Antibody
RC-15579-02 100 µL

Recombinant PROX1 Antibody

Sign In for Pricing
View Details
Recombinant PROX1 Antibody
RC-15579-03 1 mL

Recombinant PROX1 Antibody

Sign In for Pricing
View Details
Medronic Acid
TRC-M203500-50MG 50 mg

Medronic Acid

Sign In for Pricing
View Details