Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida ATP synthase protein I (atpI)

This Recombinant Pseudomonas putida ATP synthase protein I (atpI) spans the amino acid sequence from region 1-135.

Product Specifications

Product Name Alternative

ATP synthase protein I

UniProt

P0A104

Expression Region

1-135

Origin

Pseudomonas putida (Arthrobacter siderocapsulatus)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIRTPNRLPFHRWAVFPVLLAQFVVLLLATLVLWQWKGSVSGYSGLCGGLIAWLPNVYF AWKAFRFSGARAAQAIVKSFYAGEAGKMILTAVLFALTFAGVKPLAPLAVFGVFVLTLLV SWFAPLLMNKRLSRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,2-Dehydroprogesterone
TRC-D230330-5MG 5 mg

1,2-Dehydroprogesterone

Sign In for Pricing
View Details
Involucrin (IVRN/827), CF488A conjugate, 0.1mg/mL
BNC880827-100 1x 100 µL

Involucrin (IVRN/827), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PKA R2 (PRKAR2A) Rabbit Polyclonal Antibody
TA369273 100 µL

PKA R2 (PRKAR2A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Nogo Receptor (RTN4R) activation kit by CRISPRa
GA112230 1 Kit

Human Nogo Receptor (RTN4R) activation kit by CRISPRa

Sign In for Pricing
View Details
HPS1 (NM_000195) Human Recombinant Protein
TP319526L 1 mg

HPS1 (NM_000195) Human Recombinant Protein

Sign In for Pricing
View Details
GTF3A Rabbit Polyclonal Antibody
TA376861 100 µL

GTF3A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details