Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dechloromonas aromatica Protein CrcB homolog (crcB)

This Recombinant Dechloromonas aromatica Protein CrcB homolog (crcB) spans the amino acid sequence from region 1-135.

Product Specifications

Product Name Alternative

Protein CrcB homolog

UniProt

Q47AF6

Expression Region

1-135

Origin

Dechloromonas aromatica (strain RCB)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSALHQLSALNFLVIGLGAAFGAWTRWLLGLSLNPLFVALPLGTLAANVIGGYLVGVAVG IFHINTHFSLAWKLFAITGFLGGLTTFSTFSAEVVERLLAGQPAWAIGLASVHLAGSLTA TYLGLLTVGATRIWA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF647 conjugate, 0.1mg/mL
BNC470525-100 1x 100 µL

CD63 (MX-49.129.5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF647 conjugate, 0.1mg/mL
BNC470965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL
BNC680460-100 1x 100 µL

CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (LK2H10 + PHE5), CF640R conjugate, 0.1mg/mL
BNC400698-100 1x 100 µL

Chromogranin A (LK2H10 + PHE5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-x (BX006 + 2H12), CF640R conjugate, 0.1mg/mL
BNC400752-500 1x 500 µL

Bcl-x (BX006 + 2H12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (Hematopoietic Stem Cell & Endothelial Marker) (HPCA1/2598R), CF647 conjugate, 0.1mg/mL
BNC472598-100 1x 100 µL

CD34 (Hematopoietic Stem Cell & Endothelial Marker) (HPCA1/2598R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details