Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ixodes scapularis Protein KRTCAP2 homolog

This Recombinant Ixodes scapularis Protein KRTCAP2 homolog spans the amino acid sequence from region 1-135.

Product Specifications

Product Name Alternative

Protein KRTCAP2 homolog

UniProt

Q5Q995

Expression Region

1-135

Origin

Ixodes scapularis (Black-legged tick) (Deer tick)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVSSGTSGMLATCLFMLLFATMQIYKSQLTSSQPMAIVGGFLGSVLFILILTAISNFET HFFGRNFQTKLIPEVVIALVIAMAASGMVHRVCITTCLIFSIVALYYVSRISIKVHGSGA GTATAIPVTKGKKGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (66IG10), CF405S conjugate, 0.1mg/mL
BNC040871-100 1x 100 µL

CD71 (66IG10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL
BNC400669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (A53-B/A2.26), CF740 conjugate, 0.1mg/mL
BNC740020-500 1x 500 µL

Cytokeratin 19 (A53-B/A2.26), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2427), CF594 conjugate, 0.1mg/mL
BNC942427-100 1x 100 µL

P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2427), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2564R), CF568 conjugate, 0.1mg/mL
BNC682564-100 1x 100 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2564R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (NKI-C3), CF488A conjugate, 0.1mg/mL
BNC880186-500 1x 500 µL

CD63 (NKI-C3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details