Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus halodurans Uncharacterized protein BH0965 (BH0965)

This Recombinant Bacillus halodurans Uncharacterized protein BH0965 (BH0965) spans the amino acid sequence from region 1-135.

Product Specifications

Product Name Alternative

Uncharacterized protein BH0965

UniProt

Q9KE91

Expression Region

1-135

Origin

Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEALLKWSAAVLAAAVSFLYGEWTILLSILLTLVVIDYGTGLVAAGVTGNINSRVGLIGI TRKVFIFVMVAIAHMIDTVLLEVGIETEALIFMAAVVFYIVNELISIFENAGRMGLPVPK QLKQAISILKGDESK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAG1 Antibody
KC-7479-01 50 μL

PAG1 Antibody

Sign In for Pricing
View Details
PAG1 Antibody
KC-7479-02 100 µL

PAG1 Antibody

Sign In for Pricing
View Details
PAG1 Antibody
KC-7479-03 1 mL

PAG1 Antibody

Sign In for Pricing
View Details
Human ENPP5 activation kit by CRISPRa
GA111811 1 Kit

Human ENPP5 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS702023 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Fmoc-Cys (StBu) Wang Resin LL
HLL0751501309.25G 25 g

Fmoc-Cys (StBu) Wang Resin LL

Sign In for Pricing
View Details