Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein psiE (psiE)

This Recombinant Protein psiE (psiE) spans the amino acid sequence from region 1-136.

Product Specifications

Product Name Alternative

Protein psiE

UniProt

P0A7C9

Expression Region

1-136

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSLSRPRVEFISTILQTVLNLGLLCLGLILVVFLGKETVHLADVLFAPEQTSKYELVEG LVVYFLYFEFIALIVKYFQSGFHFPLRYFVYIGITAIVRLIIVDHKSPLDVLIYSAAILL LVITLWLCNSKRLKRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human COL6 (Collagen Type VI) CLIA Kit
E-CL-H0555-01 24 Tests

Human COL6 (Collagen Type VI) CLIA Kit

Sign In for Pricing
View Details
Human COL6 (Collagen Type VI) CLIA Kit
E-CL-H0555-02 48 Tests

Human COL6 (Collagen Type VI) CLIA Kit

Sign In for Pricing
View Details
Human COL6 (Collagen Type VI) CLIA Kit
E-CL-H0555-03 96 Tests

Human COL6 (Collagen Type VI) CLIA Kit

Sign In for Pricing
View Details
SOX2 (Embryonic Stem Cell Marker) (SOX2/3169R), CF594 conjugate, 0.1mg/mL
BNC943169-500 1x 500 µL

SOX2 (Embryonic Stem Cell Marker) (SOX2/3169R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IFITM5 activation kit by CRISPRa
GA117904 1 Kit

Human IFITM5 activation kit by CRISPRa

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Armenian Hamster IgG Isotype Control[PIP]
E-AB-F09852J-01 20 Tests

PerCP/Cyanine5.5 Armenian Hamster IgG Isotype Control[PIP]

Sign In for Pricing
View Details