Recombinant Protein psiE (psiE)
This Recombinant Protein psiE (psiE) spans the amino acid sequence from region 1-136.
Product Specifications
Product Name Alternative
Protein psiE
UniProt
P0A7D0
Expression Region
1-136
Origin
Shigella flexneri
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MTSLSRPRVEFISTILQTVLNLGLLCLGLILVVFLGKETVHLADVLFAPEQTSKYELVEG LVVYFLYFEFIALIVKYFQSGFHFPLRYFVYIGITAIVRLIIVDHKSPLDVLIYSAAILL LVITLWLCNSKRLKRE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6476052-01 0.1 mL
FKBP10, CT (Peptidyl-prolyl cis-trans Isomerase FKBP10, PPIase FKBP10, FK506-binding Protein 10, FKBP-10, Rotamase, Immunophilin FKBP65, 65kD FK506-binding Protein, FKBP-65, PSEC0056, FKBP65) (MaxLight 650)
Sign In for Pricing
View Details MBS6476052-02 5x 0.1 mL
FKBP10, CT (Peptidyl-prolyl cis-trans Isomerase FKBP10, PPIase FKBP10, FK506-binding Protein 10, FKBP-10, Rotamase, Immunophilin FKBP65, 65kD FK506-binding Protein, FKBP-65, PSEC0056, FKBP65) (MaxLight 650)
Sign In for Pricing
View Details 
