Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein psiE (psiE)

This Recombinant Protein psiE (psiE) spans the amino acid sequence from region 1-136.

Product Specifications

Product Name Alternative

Protein psiE

UniProt

P0A7D0

Expression Region

1-136

Origin

Shigella flexneri

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSLSRPRVEFISTILQTVLNLGLLCLGLILVVFLGKETVHLADVLFAPEQTSKYELVEG LVVYFLYFEFIALIVKYFQSGFHFPLRYFVYIGITAIVRLIIVDHKSPLDVLIYSAAILL LVITLWLCNSKRLKRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Angiopoietin 4 ANG4 ELISA Kit
BG-BVN10196 1 Each

Bovine Angiopoietin 4 ANG4 ELISA Kit

Sign In for Pricing
View Details
Recombinant Human GSTA1 Protein, N-His
orb3062622-01 50 µg

Recombinant Human GSTA1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human GSTA1 Protein, N-His
orb3062622-02 100 µg

Recombinant Human GSTA1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human GSTA1 Protein, N-His
orb3062622-03 1 mg

Recombinant Human GSTA1 Protein, N-His

Sign In for Pricing
View Details
Recombinant human DDT protein
ATGP0593-020 20 µg

Recombinant human DDT protein

Sign In for Pricing
View Details
Etifoxine 5mg
A15083-5 5 mg

Etifoxine 5mg

Sign In for Pricing
View Details