Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A Protein psiE (psiE)

This Recombinant Salmonella paratyphi A Protein psiE (psiE) spans the amino acid sequence from region 1-136.

Product Specifications

Product Name Alternative

Protein psiE

UniProt

B5BJU9

Expression Region

1-136

Origin

Salmonella paratyphi A (strain AKU_12601)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMPLSRSRLEFIATILQNVLNLGLLTLGLILIVFLGKETVHLADALFVPEQASKYELVEG LVIYFLYFEFIALIVKYFKSGLHFPLRYFVYIGITAIVRLIIVDHKTPMDVLLYSAAILL LVITLWLCNSNRLRRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD104 (UM-A9), CF740 conjugate, 0.1mg/mL
BNC740449-500 1x 500 µL

CD104 (UM-A9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF488A conjugate, 0.1mg/mL
BNC880039-500 1x 500 µL

CD34 (ICO-115), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF640R conjugate, 0.1mg/mL
BNC400333-500 1x 500 µL

CD8 (RIV11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
BNC880026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF568 conjugate, 0.1mg/mL
BNC680391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF405S conjugate, 0.1mg/mL
BNC040175-500 1x 500 µL

CD46 (122.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details