Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella agona Protein psiE (psiE)

This Recombinant Salmonella agona Protein psiE (psiE) spans the amino acid sequence from region 1-136.

Product Specifications

Product Name Alternative

Protein psiE

UniProt

B5F1P5

Expression Region

1-136

Origin

Salmonella agona (strain SL483)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMPLSRSRLEFIATILQNVLNLGLLTLGLILVVFLGKETVHLADALFVPEQASKYELVEG LVIYFLYFEFIALIVKYFKSGLHFPLRYFVYIGITAIVRLIIVDHKTPMDVLLYSAAILL LVITLWLCNSNRLRRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL
BNC400026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF555 conjugate, 0.1mg/mL
BNC550146-500 1x 500 µL

CD10 (CB-CALLA), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL
BNC880204-100 1x 100 µL

Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL
BNC680266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL
BNC470043-100 1x 100 µL

P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL
BNC740029-500 1x 500 µL

Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details