Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi C Protein psiE (psiE)

This Recombinant Salmonella paratyphi C Protein psiE (psiE) spans the amino acid sequence from region 1-136.

Product Specifications

Product Name Alternative

Protein psiE

UniProt

C0Q4D1

Expression Region

1-136

Origin

Salmonella paratyphi C (strain RKS4594)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMPLSRSRLEFIATILQNVLNLGLLTLGLILVVFLGKETVHLADALFAPEQASKYELVEG LVIYFLYFEFIALIVKYFKSGLHFPLRYFVYIGITAIVRLIIVDHKTPMDVLLYSAAILL LVITLWLCNSNRLRRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8/18 (C-51), CF740 conjugate, 0.1mg/mL
BNC740034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL
BNC740304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL
BNC550017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (VP2897R), CF405S conjugate, 0.1mg/mL
BNC042897-100 1x 100 µL

Major Vault Protein (MVP) (VP2897R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2278R), CF640R conjugate, 0.1mg/mL
BNC402278-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2278R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18) (KRT18/2819R), CF488A conjugate, 0.1mg/mL
BNC882819-100 1x 100 µL

Cytokeratin 18 (KRT18) (KRT18/2819R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details