Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1013 (AF_1013)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1013 (AF_1013) spans the amino acid sequence from region 1-136.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_1013

UniProt

O29249

Expression Region

1-136

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPPFFDFLMSAGIAFFVFIISAIILPGFFIWIGLKVVGKERDVLRCGMANFAAVVITAVV AFILHFTPLVLLLPLLAFLIYLYVLKTLLDVGFIEAFAATIIAGVVIFLLAVILLLIFGV WLLFTPPPAQMMHVKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calprotectin (S100A9) Mouse Monoclonal Antibody [Clone ID: OTI2A2]
CF804217 100 µg

Calprotectin (S100A9) Mouse Monoclonal Antibody [Clone ID: OTI2A2]

Sign In for Pricing
View Details
3Beta,5Alpha,6Beta-Trihydroxycholestane-d7
TRC-T795102-1MG 1 mg

3Beta,5Alpha,6Beta-Trihydroxycholestane-d7

Sign In for Pricing
View Details
FGFR1 Human Gene Knockout Kit (CRISPR)
KN202080 1 Kit

FGFR1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Efna4 activation kit by CRISPRa
GA201191 1 Kit

Mouse Efna4 activation kit by CRISPRa

Sign In for Pricing
View Details
FauNDI, 50 preps
FDRE1266 50 Preparations

FauNDI, 50 preps

Sign In for Pricing
View Details
TAT (NM_000353) Human Over-expression Lysate
LY424771 100 µg

TAT (NM_000353) Human Over-expression Lysate

Sign In for Pricing
View Details