Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1013 (AF_1013)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1013 (AF_1013) spans the amino acid sequence from region 1-136.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_1013

UniProt

O29249

Expression Region

1-136

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPPFFDFLMSAGIAFFVFIISAIILPGFFIWIGLKVVGKERDVLRCGMANFAAVVITAVV AFILHFTPLVLLLPLLAFLIYLYVLKTLLDVGFIEAFAATIIAGVVIFLLAVILLLIFGV WLLFTPPPAQMMHVKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TyraMaxTM 680/700 Amplification Dye, 100X
#96143-100UL 1x 100 µL

TyraMaxTM 680/700 Amplification Dye, 100X

Sign In for Pricing
View Details
MAD2 (MAD2L1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4D2]
TA500617BM 100 µL

MAD2 (MAD2L1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4D2]

Sign In for Pricing
View Details
Glycocholic Acid Hydrate Sodium Salt
TRC-G641360-50G 50 g

Glycocholic Acid Hydrate Sodium Salt

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2953), Biotin conjugate, 0.1mg/mL
BNCB2953-500 1x 500 µL

C1QA / Complement C1q A-Chain (C1QA/2953), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS807782 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
TEF (NM_003216) Human Over-expression Lysate
LY418831 100 µg

TEF (NM_003216) Human Over-expression Lysate

Sign In for Pricing
View Details