Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1013 (AF_1013)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1013 (AF_1013) spans the amino acid sequence from region 1-136.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_1013

UniProt

O29249

Expression Region

1-136

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPPFFDFLMSAGIAFFVFIISAIILPGFFIWIGLKVVGKERDVLRCGMANFAAVVITAVV AFILHFTPLVLLLPLLAFLIYLYVLKTLLDVGFIEAFAATIIAGVVIFLLAVILLLIFGV WLLFTPPPAQMMHVKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOXD9 Rabbit Polyclonal Antibody
TA368518 100 µL

HOXD9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FGF2 Rabbit Polyclonal Antibody
AP02009SU-S 20 µL

FGF2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Reep5 activation kit by CRISPRa
GA201116 1 Kit

Mouse Reep5 activation kit by CRISPRa

Sign In for Pricing
View Details
Calpain 10 (CAPN10) Human Gene Knockout Kit (CRISPR)
KN402556 1 Kit

Calpain 10 (CAPN10) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Bulk Anti-Human CD45 (BC8) Antibody
ICH1155-5mg 5 mg

Bulk Anti-Human CD45 (BC8) Antibody

Sign In for Pricing
View Details
IL37 Antibody
KC-2992-01 50 μL

IL37 Antibody

Sign In for Pricing
View Details