Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Membrane-bound negative regulator yvrL (yvrL)

This Recombinant Bacillus subtilis Membrane-bound negative regulator yvrL (yvrL) spans the amino acid sequence from region 1-136.

Product Specifications

Product Name Alternative

Membrane-bound negative regulator yvrL

UniProt

O34686

Expression Region

1-136

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKHQNPSKRLLRLSIKYLLAAAAVVLTYFAVIYILFSLAGTSYRSAAHVLLFAVVFLVLG LCFEPFERLMIHSFTFFKTGKRLFILLAGIVQLLFLWMTAHTTDQLISDIWLSTTEEMIV AAVFLILDKCNSALPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCBD1 Recombinant Antibody, PerCP-Cy5.5 Conjugated
bsm-62561R-PerCP-Cy5.5 100 µL

PCBD1 Recombinant Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
Synthetic Human Cross Linked N-Telopeptide Of Type I Collagen (NTXI)
RPU50022-01 50 µg

Synthetic Human Cross Linked N-Telopeptide Of Type I Collagen (NTXI)

Sign In for Pricing
View Details
Synthetic Human Cross Linked N-Telopeptide Of Type I Collagen (NTXI)
RPU50022-02 100 µg

Synthetic Human Cross Linked N-Telopeptide Of Type I Collagen (NTXI)

Sign In for Pricing
View Details
Synthetic Human Cross Linked N-Telopeptide Of Type I Collagen (NTXI)
RPU50022-03 1 mg

Synthetic Human Cross Linked N-Telopeptide Of Type I Collagen (NTXI)

Sign In for Pricing
View Details
RAB7 (J7A24) Rabbit mAb
C06409-100uL 100 µL

RAB7 (J7A24) Rabbit mAb

Sign In for Pricing
View Details
PLA30000-PEG3400-MAL
S01YF-0723-KX115 Each

PLA30000-PEG3400-MAL

Sign In for Pricing
View Details