Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 203 (TMEM203)

This Recombinant Human Transmembrane protein 203 (TMEM203) spans the amino acid sequence from region 1-136.

Product Specifications

Product Name Alternative

Transmembrane protein 203

UniProt

Q969S6

Expression Region

1-136

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLFSLRELVQWLGFATFEIFVHLLALLVFSVLLALRVDGLVPGLSWWNVFVPFFAADGLS TYFTTIVSVRLFQDGEKRLAVLRLFWVLTVLSLKFVFEMLLCQKLAEQTRELWFGLITSP LFILLQLLMIRACRVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6430598A04Rik Protein Vector (Mouse) (pPM-C-HA)
10845024 500 ng

6430598A04Rik Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Rabbit Polyclonal Osterix/Sp7 Antibody [Alexa Fluor 405]
NBP2-98576AF405 0.1 mL

Rabbit Polyclonal Osterix/Sp7 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
SPIC (NM_152323) Human Tagged Lenti ORF Clone
RC207166L3 10 µg

SPIC (NM_152323) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
OR4F28P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1509606 1.0 µg DNA

OR4F28P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
MS-1020 (1-Hydroxy-N-(2-(5-hydroxy-1H-indol-3-yl)ethyl)-2-naphthamide)
MBS6098352-01 1 mg

MS-1020 (1-Hydroxy-N-(2-(5-hydroxy-1H-indol-3-yl)ethyl)-2-naphthamide)

Sign In for Pricing
View Details
MS-1020 (1-Hydroxy-N-(2-(5-hydroxy-1H-indol-3-yl)ethyl)-2-naphthamide)
MBS6098352-02 5x 1 mg

MS-1020 (1-Hydroxy-N-(2-(5-hydroxy-1H-indol-3-yl)ethyl)-2-naphthamide)

Sign In for Pricing
View Details