Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 203 (TMEM203)

This Recombinant Human Transmembrane protein 203 (TMEM203) spans the amino acid sequence from region 1-136.

Product Specifications

Product Name Alternative

Transmembrane protein 203

UniProt

Q969S6

Expression Region

1-136

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLFSLRELVQWLGFATFEIFVHLLALLVFSVLLALRVDGLVPGLSWWNVFVPFFAADGLS TYFTTIVSVRLFQDGEKRLAVLRLFWVLTVLSLKFVFEMLLCQKLAEQTRELWFGLITSP LFILLQLLMIRACRVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(3S,4S)-Tofacitinib
TRC-T528005-50MG 50 mg

(3S,4S)-Tofacitinib

Sign In for Pricing
View Details
Acetylshikonin
S9257-1mg 1 mg

Acetylshikonin

Sign In for Pricing
View Details
VWF Polyclonal Antibody
RA20601-01 50 µL

VWF Polyclonal Antibody

Sign In for Pricing
View Details
VWF Polyclonal Antibody
RA20601-02 100 µL

VWF Polyclonal Antibody

Sign In for Pricing
View Details
ZNF499 Peptide - middle region (AAP30017)
AAP30017-100UG 100 µg

ZNF499 Peptide - middle region (AAP30017)

Sign In for Pricing
View Details
SASH1, ID (SASH1, KIAA0790, PEPE1, SAM and SH3 domain-containing protein 1, Proline-glutamate repeat-containing protein) (Biotin) discontinued
041428-Biotin 200 µL

SASH1, ID (SASH1, KIAA0790, PEPE1, SAM and SH3 domain-containing protein 1, Proline-glutamate repeat-containing protein) (Biotin) discontinued

Sign In for Pricing
View Details