Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein psiE (psiE)

This Recombinant Protein psiE (psiE) spans the amino acid sequence from region 1-136.

Product Specifications

Product Name Alternative

Protein psiE

UniProt

Q8X5X8

Expression Region

1-136

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSLSRPRVEFISTILQTVLNLGLLCLGLILVVFLGKETVHLADVLFAPEQASKYELVEG LVVYFLYFEFIALIVKYFQSGFHFPLRYFVYIGITAIVRLIIVDHKSPLDVLIYSAAILL LVVTLWLCNSKRLKRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL26P3 Adenovirus (Human)
41254051 1.0 mL

RPL26P3 Adenovirus (Human)

Sign In for Pricing
View Details
TRNAP18 Protein Vector (Human) (pPM-C-HA)
48259021 500 ng

TRNAP18 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (SOX9/2387), CF740 conjugate, 0.1mg/mL
BNC742387-500 1x 500 µL

SOX9 / SRY-box 9 (SOX9/2387), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FA2 glycan (G0F), APTS labelled
HY-158527 1 Each

FA2 glycan (G0F), APTS labelled

Sign In for Pricing
View Details
KLHL1 Overexpression Lysate (Native) - (Dry Ice)
NBP2-06596 0.1 mg

KLHL1 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Mitochondrial outer membrane protein C83.16c (SPBC83.16c)
MBS7040065-01 0.02 mg

Recombinant Schizosaccharomyces pombe Mitochondrial outer membrane protein C83.16c (SPBC83.16c)

Sign In for Pricing
View Details