Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein psiE (psiE)

This Recombinant Protein psiE (psiE) spans the amino acid sequence from region 1-136.

Product Specifications

Product Name Alternative

Protein psiE

UniProt

Q8X5X8

Expression Region

1-136

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSLSRPRVEFISTILQTVLNLGLLCLGLILVVFLGKETVHLADVLFAPEQASKYELVEG LVVYFLYFEFIALIVKYFQSGFHFPLRYFVYIGITAIVRLIIVDHKSPLDVLIYSAAILL LVVTLWLCNSKRLKRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOLR2 (NM_001113536) Human 3' UTR Clone
SC202270 10 µg

FOLR2 (NM_001113536) Human 3' UTR Clone

Sign In for Pricing
View Details
RAD52 (NM_134424) Human Over-expression Lysate
LY408748 100 µg

RAD52 (NM_134424) Human Over-expression Lysate

Sign In for Pricing
View Details
Sororin (B-9) PE
sc-365319 PE 200 µg/mL

Sororin (B-9) PE

Sign In for Pricing
View Details
V5 Affinity Purified Antibody, HRP Conjugated
MBS194381-01 0.1 mg

V5 Affinity Purified Antibody, HRP Conjugated

Sign In for Pricing
View Details
V5 Affinity Purified Antibody, HRP Conjugated
MBS194381-02 5x 0.1 mg

V5 Affinity Purified Antibody, HRP Conjugated

Sign In for Pricing
View Details
PCMV6-OGA-3*FLAG
BZ64831 1 Vial

PCMV6-OGA-3*FLAG

Sign In for Pricing
View Details